SCOPe 2.08: Domain d2i2vi2: 2i2v I:1-72

Lineage for d2i2vi2 (2i2v I:1-72)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.47: Ribosomal L11/L12e N-terminal domain [54746] (1 superfamily)
   beta-alpha(2)-beta(2); 2 layers, alpha/beta; antiparallel beta-sheet: order 123

4. Superfamily d.47.1: Ribosomal L11/L12e N-terminal domain [54747] (1 family)

5. Family d.47.1.1: Ribosomal L11/L12e N-terminal domain [54748] (2 proteins)
   Pfam PF03946

6. Protein Ribosomal protein L11, N-terminal domain [54749] (4 species)

7. Species Escherichia coli [TaxId:562] [160201] (29 PDB entries)
   Uniprot P0A7J7 1-72

8. Domain d2i2vi2: 2i2v I:1-72 [145493]
   Other proteins in same PDB: d2i2v01, d2i2v11, d2i2v21, d2i2v31, d2i2v41, d2i2vc1, d2i2vc2, d2i2vd1, d2i2ve1, d2i2vf1, d2i2vg1, d2i2vg2, d2i2vh1, d2i2vh2, d2i2vi1, d2i2vj1, d2i2vk1, d2i2vl1, d2i2vm1, d2i2vn1, d2i2vo1, d2i2vp1, d2i2vq1, d2i2vr1, d2i2vs1, d2i2vt1, d2i2vu1, d2i2vv1, d2i2vw1, d2i2vx1, d2i2vy1, d2i2vz1
   protein/RNA complex; complexed with mg, zn
   protein/RNA complex; complexed with mg, zn

Details for d2i2vi2

PDB Entry: 2i2v, 3.22 Å

PDB Description: Crystal Structure of Ribosome with messenger RNA and the Anticodon stem-loop of P-site tRNA. This file contains the 50s subunit of one 70s ribosome. The entire crystal structure contains two 70s ribosomes and is described in remark 400.

PDB Compounds: (I:) 50S ribosomal protein L11

SCOPe Domain Sequences for d2i2vi2:

Sequence; same for both SEQRES and ATOM records:

>d2i2vi2 d.47.1.1 (I:1-72) Ribosomal protein L11, N-terminal domain {Escherichia coli [TaxId: 562]}
akkvqayvklqvaagmanpsppvgpalgqqgvnimefckafnaktdsiekglpipvvitv
yadrsftfvtkt

Timeline for d2i2vi2:

• d2i2vi2 first appeared in SCOP 1.75
  
• d2i2vi2 appears in SCOPe 2.07