SCOPe 2.08: Domain d2i2vh2: 2i2v H:1-58

Lineage for d2i2vh2 (2i2v H:1-58)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.100: MbtH/L9 domain-like [55657] (2 superfamilies)
   beta(2)-alpha-beta-alpha; 3 layers: alpha/beta/alpha

4. Superfamily d.100.1: L9 N-domain-like [55658] (3 families)

5. Family d.100.1.1: Ribosomal protein L9 N-domain [55659] (1 protein)
   automatically mapped to Pfam PF01281

6. Protein Ribosomal protein L9 N-domain [55660] (3 species)

7. Species Escherichia coli [TaxId:562] [160581] (29 PDB entries)
   Uniprot P0A7R1 1-58

8. Domain d2i2vh2: 2i2v H:1-58 [145491]
   Other proteins in same PDB: d2i2v01, d2i2v11, d2i2v21, d2i2v31, d2i2v41, d2i2vc1, d2i2vc2, d2i2vd1, d2i2ve1, d2i2vf1, d2i2vg1, d2i2vg2, d2i2vh1, d2i2vi1, d2i2vi2, d2i2vj1, d2i2vk1, d2i2vl1, d2i2vm1, d2i2vn1, d2i2vo1, d2i2vp1, d2i2vq1, d2i2vr1, d2i2vs1, d2i2vt1, d2i2vu1, d2i2vv1, d2i2vw1, d2i2vx1, d2i2vy1, d2i2vz1
   protein/RNA complex; complexed with mg, zn
   protein/RNA complex; complexed with mg, zn

Details for d2i2vh2

PDB Entry: 2i2v, 3.22 Å

PDB Description: Crystal Structure of Ribosome with messenger RNA and the Anticodon stem-loop of P-site tRNA. This file contains the 50s subunit of one 70s ribosome. The entire crystal structure contains two 70s ribosomes and is described in remark 400.

PDB Compounds: (H:) 50S ribosomal protein L9

SCOPe Domain Sequences for d2i2vh2:

Sequence; same for both SEQRES and ATOM records:

>d2i2vh2 d.100.1.1 (H:1-58) Ribosomal protein L9 N-domain {Escherichia coli [TaxId: 562]}
mqvilldkvanlgslgdqvnvkagyarnflvpqgkavpatkknieffearraeleakl

Timeline for d2i2vh2:

• d2i2vh2 first appeared in SCOP 1.75
  
• d2i2vh2 appears in SCOPe 2.07