Lineage for d2i2uu1 (2i2u U:3-53)

  1. Root: SCOPe 2.06
  2. 2271421Class j: Peptides [58231] (133 folds)
  3. 2273286Fold j.122: Ribosomal protein S21p [161307] (1 superfamily)
    non-globular, mainly alpha-helical
  4. 2273287Superfamily j.122.1: Ribosomal protein S21p [161308] (1 family) (S)
  5. 2273288Family j.122.1.1: Ribosomal protein S21p [161309] (1 protein)
    Pfam PF01165
  6. 2273289Protein Ribosomal protein S21, RpsU [161310] (1 species)
  7. 2273290Species Escherichia coli [TaxId:562] [161311] (24 PDB entries)
    Uniprot P68679 4-54
  8. 2273300Domain d2i2uu1: 2i2u U:3-53 [145482]
    Other proteins in same PDB: d2i2ub1, d2i2uc1, d2i2uc2, d2i2ud1, d2i2ue1, d2i2ue2, d2i2uf1, d2i2ug1, d2i2uh1, d2i2ui1, d2i2uj1, d2i2uk1, d2i2ul1, d2i2um1, d2i2un1, d2i2uo1, d2i2up1, d2i2uq1, d2i2ur1, d2i2us1, d2i2ut1
    protein/RNA complex; complexed with mg
    protein/RNA complex; complexed with mg

Details for d2i2uu1

PDB Entry: 2i2u (more details), 3.22 Å

PDB Description: Crystal Structure of Ribosome with messenger RNA and the Anticodon stem-loop of P-site tRNA. This file contains the 30s subunit of one 70s ribosome. The entire crystal structure contains two 70s ribosomes and is described in remark 400.
PDB Compounds: (U:) 30S ribosomal protein S21

SCOPe Domain Sequences for d2i2uu1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i2uu1 j.122.1.1 (U:3-53) Ribosomal protein S21, RpsU {Escherichia coli [TaxId: 562]}
ikvrenepfdvalrrfkrscekagvlaevrrrefyekptterkrakasavk

SCOPe Domain Coordinates for d2i2uu1:

Click to download the PDB-style file with coordinates for d2i2uu1.
(The format of our PDB-style files is described here.)

Timeline for d2i2uu1: