SCOPe 2.02: Domain d2i2ur1: 2i2u R:19-73

Lineage for d2i2ur1 (2i2u R:19-73)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.8: Ribosomal protein S18 [46911] (1 family)

5. Family a.4.8.1: Ribosomal protein S18 [46912] (1 protein)

6. Protein Ribosomal protein S18 [46913] (2 species)

7. Species Escherichia coli [TaxId:562] [158351] (24 PDB entries)
   Uniprot P0A7T7 19-73

8. Domain d2i2ur1: 2i2u R:19-73 [145479]
   Other proteins in same PDB: d2i2ub1, d2i2uc1, d2i2uc2, d2i2ud1, d2i2ue1, d2i2ue2, d2i2uf1, d2i2ug1, d2i2uh1, d2i2ui1, d2i2uj1, d2i2uk1, d2i2ul1, d2i2um1, d2i2un1, d2i2uo1, d2i2up1, d2i2uq1, d2i2us1, d2i2ut1, d2i2uu1
   automatically matched to 2AVY R:19-73
   protein/RNA complex; complexed with mg

Details for d2i2ur1

PDB Entry: 2i2u, 3.22 Å

PDB Description: Crystal Structure of Ribosome with messenger RNA and the Anticodon stem-loop of P-site tRNA. This file contains the 30s subunit of one 70s ribosome. The entire crystal structure contains two 70s ribosomes and is described in remark 400.

PDB Compounds: (R:) 30S ribosomal protein S18

SCOPe Domain Sequences for d2i2ur1:

Sequence; same for both SEQRES and ATOM records:

>d2i2ur1 a.4.8.1 (R:19-73) Ribosomal protein S18 {Escherichia coli [TaxId: 562]}
eidykdiatlknyitesgkivpsritgtrakyqrqlaraikrarylsllpytdrh

Timeline for d2i2ur1:

• d2i2ur1 first appeared in SCOP 1.75
  
• d2i2ur1 appears in SCOPe 2.01
  
• d2i2ur1 appears in SCOPe 2.03
  
• d2i2ur1 appears in the current release, SCOPe 2.08