![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.27: Ribosomal protein S16 [54564] (1 superfamily) beta(4)-alpha-beta; 2 layers: alpha/beta; mixed beta-sheet, order: 51234 |
![]() | Superfamily d.27.1: Ribosomal protein S16 [54565] (1 family) ![]() |
![]() | Family d.27.1.1: Ribosomal protein S16 [54566] (1 protein) |
![]() | Protein Ribosomal protein S16 [54567] (3 species) |
![]() | Species Escherichia coli [TaxId:562] [160143] (26 PDB entries) Uniprot P0A7T3 1-82 |
![]() | Domain d2i2up1: 2i2u P:1-80 [145477] Other proteins in same PDB: d2i2ub1, d2i2uc1, d2i2uc2, d2i2ud1, d2i2ue1, d2i2ue2, d2i2uf1, d2i2ug1, d2i2uh1, d2i2ui1, d2i2uj1, d2i2uk1, d2i2ul1, d2i2um1, d2i2un1, d2i2uo1, d2i2uq1, d2i2ur1, d2i2us1, d2i2ut1, d2i2uu1 automatically matched to 2AVY P:1-82 protein/RNA complex; complexed with mg |
PDB Entry: 2i2u (more details), 3.22 Å
SCOPe Domain Sequences for d2i2up1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i2up1 d.27.1.1 (P:1-80) Ribosomal protein S16 {Escherichia coli [TaxId: 562]} mvtirlarhgakkrpfyqvvvadsrnarngrfiervgffnpiasekeegtrldldriahw vgqgatisdrvaalikevnk
Timeline for d2i2up1: