Lineage for d2i2uo1 (2i2u O:1-88)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2311085Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily)
    3 helices; irregular array
  4. 2311086Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (4 families) (S)
  5. 2311142Family a.16.1.2: Ribosomal protein S15 [47064] (1 protein)
    contains additional N-terminal helix that forms a separate unit
    automatically mapped to Pfam PF00312
  6. 2311143Protein Ribosomal protein S15 [47065] (3 species)
  7. 2311146Species Escherichia coli [TaxId:562] [158383] (10 PDB entries)
    Uniprot Q8X9M2 2-89
  8. 2311150Domain d2i2uo1: 2i2u O:1-88 [145476]
    Other proteins in same PDB: d2i2ub1, d2i2uc1, d2i2uc2, d2i2ud1, d2i2ue1, d2i2ue2, d2i2uf1, d2i2ug1, d2i2uh1, d2i2ui1, d2i2uj1, d2i2uk1, d2i2ul1, d2i2um1, d2i2un1, d2i2up1, d2i2uq1, d2i2ur1, d2i2us1, d2i2ut1, d2i2uu1
    protein/RNA complex; complexed with mg
    protein/RNA complex; complexed with mg

Details for d2i2uo1

PDB Entry: 2i2u (more details), 3.22 Å

PDB Description: Crystal Structure of Ribosome with messenger RNA and the Anticodon stem-loop of P-site tRNA. This file contains the 30s subunit of one 70s ribosome. The entire crystal structure contains two 70s ribosomes and is described in remark 400.
PDB Compounds: (O:) 30S ribosomal protein S15

SCOPe Domain Sequences for d2i2uo1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i2uo1 a.16.1.2 (O:1-88) Ribosomal protein S15 {Escherichia coli [TaxId: 562]}
slsteatakivsefgrdandtgstevqvalltaqinhlqghfaehkkdhhsrrgllrmvs
qrrklldylkrkdvarytrlierlglrr

SCOPe Domain Coordinates for d2i2uo1:

Click to download the PDB-style file with coordinates for d2i2uo1.
(The format of our PDB-style files is described here.)

Timeline for d2i2uo1: