Lineage for d2i2uf1 (2i2u F:1-100)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1650133Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1653465Superfamily d.58.14: Ribosomal protein S6 [54995] (1 family) (S)
  5. 1653466Family d.58.14.1: Ribosomal protein S6 [54996] (1 protein)
  6. 1653467Protein Ribosomal protein S6 [54997] (4 species)
  7. 1653470Species Escherichia coli [TaxId:562] [160317] (24 PDB entries)
    Uniprot P02358 1-100
  8. 1653486Domain d2i2uf1: 2i2u F:1-100 [145468]
    Other proteins in same PDB: d2i2ub1, d2i2uc1, d2i2uc2, d2i2ud1, d2i2ue1, d2i2ue2, d2i2ug1, d2i2uh1, d2i2ui1, d2i2uj1, d2i2uk1, d2i2ul1, d2i2um1, d2i2un1, d2i2uo1, d2i2up1, d2i2uq1, d2i2ur1, d2i2us1, d2i2ut1, d2i2uu1
    automatically matched to 2AVY F:1-100
    protein/RNA complex; complexed with mg

Details for d2i2uf1

PDB Entry: 2i2u (more details), 3.22 Å

PDB Description: Crystal Structure of Ribosome with messenger RNA and the Anticodon stem-loop of P-site tRNA. This file contains the 30s subunit of one 70s ribosome. The entire crystal structure contains two 70s ribosomes and is described in remark 400.
PDB Compounds: (F:) 30S ribosomal protein S6

SCOPe Domain Sequences for d2i2uf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i2uf1 d.58.14.1 (F:1-100) Ribosomal protein S6 {Escherichia coli [TaxId: 562]}
mrhyeivfmvhpdqseqvpgmierytaaitgaegkihrledwgrrqlaypinklhkahyv
lmnveapqevidelettfrfndavirsmvmrtkhavteas

SCOPe Domain Coordinates for d2i2uf1:

Click to download the PDB-style file with coordinates for d2i2uf1.
(The format of our PDB-style files is described here.)

Timeline for d2i2uf1: