Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.100: MbtH/L9 domain-like [55657] (2 superfamilies) beta(2)-alpha-beta-alpha; 3 layers: alpha/beta/alpha |
Superfamily d.100.1: L9 N-domain-like [55658] (2 families) |
Family d.100.1.1: Ribosomal protein L9 N-domain [55659] (1 protein) |
Protein Ribosomal protein L9 N-domain [55660] (3 species) |
Species Escherichia coli [TaxId:562] [160581] (29 PDB entries) Uniprot P0A7R1 1-58 |
Domain d2i2th2: 2i2t H:1-58 [145449] Other proteins in same PDB: d2i2t01, d2i2t11, d2i2t21, d2i2t31, d2i2t41, d2i2tc1, d2i2tc2, d2i2td1, d2i2te1, d2i2tf1, d2i2tg1, d2i2tg2, d2i2th1, d2i2ti1, d2i2ti2, d2i2tj1, d2i2tk1, d2i2tl1, d2i2tm1, d2i2tn1, d2i2to1, d2i2tp1, d2i2tq1, d2i2tr1, d2i2ts1, d2i2tt1, d2i2tu1, d2i2tv1, d2i2tw1, d2i2tx1, d2i2ty1, d2i2tz1 automatically matched to 2AW4 H:1-58 complexed with mg, zn |
PDB Entry: 2i2t (more details), 3.22 Å
SCOP Domain Sequences for d2i2th2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i2th2 d.100.1.1 (H:1-58) Ribosomal protein L9 N-domain {Escherichia coli [TaxId: 562]} mqvilldkvanlgslgdqvnvkagyarnflvpqgkavpatkknieffearraeleakl
Timeline for d2i2th2:
View in 3D Domains from other chains: (mouse over for more information) d2i2t01, d2i2t11, d2i2t21, d2i2t31, d2i2t41, d2i2tc1, d2i2tc2, d2i2td1, d2i2te1, d2i2tf1, d2i2tg1, d2i2tg2, d2i2ti1, d2i2ti2, d2i2tj1, d2i2tk1, d2i2tl1, d2i2tm1, d2i2tn1, d2i2to1, d2i2tp1, d2i2tq1, d2i2tr1, d2i2ts1, d2i2tt1, d2i2tu1, d2i2tv1, d2i2tw1, d2i2tx1, d2i2ty1, d2i2tz1 |