Lineage for d2i2pq1 (2i2p Q:3-82)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2397497Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2398897Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2399296Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (32 proteins)
    barrel, closed; n=5, S=8
  6. 2399628Protein Ribosomal protein S17 [50304] (3 species)
  7. 2399631Species Escherichia coli [TaxId:562] [159088] (26 PDB entries)
    Uniprot P02373 3-82
  8. 2399638Domain d2i2pq1: 2i2p Q:3-82 [145436]
    Other proteins in same PDB: d2i2pb1, d2i2pc1, d2i2pc2, d2i2pd1, d2i2pe1, d2i2pe2, d2i2pf1, d2i2pg1, d2i2ph1, d2i2pi1, d2i2pj1, d2i2pk1, d2i2pl1, d2i2pm1, d2i2pn1, d2i2po1, d2i2pp1, d2i2pr1, d2i2ps1, d2i2pt1, d2i2pu1
    protein/RNA complex; complexed with mg
    protein/RNA complex; complexed with mg

Details for d2i2pq1

PDB Entry: 2i2p (more details), 3.22 Å

PDB Description: Crystal Structure of Ribosome with messenger RNA and the Anticodon stem-loop of P-site tRNA. This file contains the 30s subunit of one 70s ribosome. The entire crystal structure contains two 70s ribosomes and is described in remark 400.
PDB Compounds: (Q:) 30S ribosomal protein S17

SCOPe Domain Sequences for d2i2pq1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i2pq1 b.40.4.5 (Q:3-82) Ribosomal protein S17 {Escherichia coli [TaxId: 562]}
kirtlqgrvvsdkmeksivvaierfvkhpiygkfikrttklhvhdennecgigdvveire
crplsktkswtlvrvvekav

SCOPe Domain Coordinates for d2i2pq1:

Click to download the PDB-style file with coordinates for d2i2pq1.
(The format of our PDB-style files is described here.)

Timeline for d2i2pq1: