Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (22 species) not a true protein |
Species Nurse shark (Ginglymostoma cirratum) [TaxId:7801] [187220] (4 PDB entries) |
Domain d2i26o2: 2i26 O:2-112 [145418] Other proteins in same PDB: d2i26l_, d2i26m_, d2i26n1, d2i26n2, d2i26o3, d2i26p3, d2i26q_ automated match to d2i26n1 complexed with so4 |
PDB Entry: 2i26 (more details), 2.5 Å
SCOPe Domain Sequences for d2i26o2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i26o2 b.1.1.1 (O:2-112) automated matches {Nurse shark (Ginglymostoma cirratum) [TaxId: 7801]} rvdqtpqtitketgesltincvlrdsncalsstywyrkksgstneesiskggryvetvns gsksfslrindltvedsgtyrckpesrygsydaecaalndqygggtvvtvn
Timeline for d2i26o2: