SCOPe 2.07: Domain d2hyec2: 2hye C:55-401

Lineage for d2hyec2 (2hye C:55-401)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.17: Cullin repeat-like [74788] (3 families)

5. Family a.118.17.1: Cullin repeat [74789] (2 proteins)
   this is a repeat family; one repeat unit is 1u6g A:175-198 found in domain

6. Protein Cullin-4A [158789] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [158790] (1 PDB entry)
   Uniprot Q13619 55-401

8. Domain d2hyec2: 2hye C:55-401 [145415]
   Other proteins in same PDB: d2hyeb_, d2hyec1, d2hyec3, d2hyed_
   complexed with zn

Details for d2hyec2

PDB Entry: 2hye, 3.1 Å

PDB Description: crystal structure of the ddb1-cul4a-rbx1-sv5v complex

PDB Compounds: (C:) Cullin-4A

SCOPe Domain Sequences for d2hyec2:

Sequence; same for both SEQRES and ATOM records:

>d2hyec2 a.118.17.1 (C:55-401) Cullin-4A {Human (Homo sapiens) [TaxId: 9606]}
pdnytqdtwrklheavravqsstsirynleelyqavenlcshkvspmlykqlrqacedhv
qaqilpfredsldsvlflkkintcwqdhcrqmimirsiflfldrtyvlqnstlpsiwdmg
lelfrthiisdkmvqsktidgilllierersgeavdrsllrsllgmlsdlqvykdsfelk
fleetnclyaaegqrlmqerevpeylnhvskrleeegdrvityldhstqkpliacvekql
lgehltailqkgldhlldenrvpdlaqmyqlfsrvrggqqallqhwseyiktfgtaivin
pekdkdmvqdlldfkdkvdhvievcfqknerfvnlmkesfetfinkr

Timeline for d2hyec2:

• d2hyec2 first appeared in SCOP 1.75
  
• d2hyec2 appears in SCOPe 2.06
  
• d2hyec2 appears in the current release, SCOPe 2.08