| Class g: Small proteins [56992] (90 folds) |
| Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
Superfamily g.41.16: Nop10-like SnoRNP [144210] (1 family) ![]() |
| Family g.41.16.1: Nucleolar RNA-binding protein Nop10-like [144211] (2 proteins) Pfam PF04135; contains N-terminal zinc-finger domain similar to the insert finger of the Initiation factor eIF2 gamma subunit ((75204)) |
| Protein Ribosome biogenesis protein Nop10 [144214] (2 species) |
| Species Archaeon Pyrococcus furiosus [TaxId:2261] [144215] (3 PDB entries) Uniprot Q8U1R4 4-55 |
| Domain d2hvyc1: 2hvy C:3-55 [145412] Other proteins in same PDB: d2hvya1, d2hvya2, d2hvyb1, d2hvyd1 complexed with atp, zn; mutant |
PDB Entry: 2hvy (more details), 2.3 Å
SCOP Domain Sequences for d2hvyc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hvyc1 g.41.16.1 (C:3-55) Ribosome biogenesis protein Nop10 {Archaeon Pyrococcus furiosus [TaxId: 2261]}
frirkcpkcgrytlkevcpvcgektkvahpprfspedpygeyrrrwkrevlgi
Timeline for d2hvyc1:
View in 3DDomains from other chains: (mouse over for more information) d2hvya1, d2hvya2, d2hvyb1, d2hvyd1 |