Lineage for d2htla1 (2htl A:17-460)

  1. Root: SCOPe 2.02
  2. 1236525Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1237763Fold f.20: Clc chloride channel [81341] (1 superfamily)
    core: 18 transmembrane helices
  4. 1237764Superfamily f.20.1: Clc chloride channel [81340] (1 family) (S)
  5. 1237765Family f.20.1.1: Clc chloride channel [69912] (1 protein)
    duplication: consist of two similar structural parts
  6. 1237766Protein Clc chloride channel [69913] (2 species)
  7. 1237767Species Escherichia coli [TaxId:562] [69914] (18 PDB entries)
  8. 1237780Domain d2htla1: 2htl A:17-460 [145408]
    Other proteins in same PDB: d2htld1, d2htld2, d2htlf1, d2htlf2
    complexed with br; mutant

Details for d2htla1

PDB Entry: 2htl (more details), 3.4 Å

PDB Description: structure of the escherichia coli clc chloride channel y445f mutant and fab complex
PDB Compounds: (A:) H(+)/Cl(-) exchange transporter clcA

SCOPe Domain Sequences for d2htla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2htla1 f.20.1.1 (A:17-460) Clc chloride channel {Escherichia coli [TaxId: 562]}
rrrqlirqllerdktplailfmaavvgtlvglaavafdkgvawlqnqrmgalvhtadnyp
llltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqrpvrwwrvlpvkffggl
gtlgggmvlgregptvqiggnigrmvldifrlkgdearhtllatgaaaglaaafnaplag
ilfiieemrpqfrytlisikavfigvimstimyrifnhevalidvgklsdaplntlwlyl
ilgiifgifgpifnkwvlgmqdllhrvhggnitkwvlmggaigglcgllgfvapatsggg
fnlipiatagnfsmgmlvfifvarvittllcfssgapggifapmlalgtvlgtafgmvav
elfpqyhleagtfaiagmgallaasirapltgiilvlemtdnyqlilpmiitglgatlla
qftggkplfsailartlakqeaeq

SCOPe Domain Coordinates for d2htla1:

Click to download the PDB-style file with coordinates for d2htla1.
(The format of our PDB-style files is described here.)

Timeline for d2htla1: