Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
Superfamily d.110.6: Sensory domain-like [103190] (3 families) alpha(2)-beta(2)-alpha(2)-beta(3); possibly related to the PAS domain |
Family d.110.6.3: LuxQ-periplasmic domain-like [160679] (1 protein) Pfam PF09308; two-domain arrangement similar to the YkuI C-terminal domain-like |
Protein Autoinducer 2 sensor kinase/phosphatase LuxQ [160680] (3 species) |
Species Vibrio harveyi [TaxId:669] [160681] (3 PDB entries) Uniprot P54302 51-271! Uniprot P54302 52-270 |
Domain d2hj9c1: 2hj9 C:52-270 [145395] Other proteins in same PDB: d2hj9a_, d2hj9b_ the second PAS-domain is partly disordered in the crystal complexed with ai2 |
PDB Entry: 2hj9 (more details), 2.34 Å
SCOPe Domain Sequences for d2hj9c1:
Sequence, based on SEQRES records: (download)
>d2hj9c1 d.110.6.3 (C:52-270) Autoinducer 2 sensor kinase/phosphatase LuxQ {Vibrio harveyi [TaxId: 669]} skqqtsalihnifdshfaaiqihhdsnsksevirdfytdrdtdvlnffflsidqsdpsht pefrfltdhkgiiwddgnahfygvndlildslanrvsfsnnwyyinvmtsigsrhmlvrr vpildpstgevlgfsfnavvldnnfalmeklksesnvdnvvlvansvplansligdepyn vadvlqrkssdkrldkllvietpivvnavttelclltvq
>d2hj9c1 d.110.6.3 (C:52-270) Autoinducer 2 sensor kinase/phosphatase LuxQ {Vibrio harveyi [TaxId: 669]} skqqtsalihnifdshfaaiqihhdsnsksevirdfytdrdtdvlnffflsidqsdpsht pefrfltdhkgiiwddgnahfygvndlildslanrvsfsnnwyyinvmtsigsrhmlvrr vpildpstgevlgfsfnavvldnnfalmeklksesnvdnvvlvansvplansligdepyn vadvlqrllvietpivvnavttelclltvq
Timeline for d2hj9c1: