SCOP 1.75: Domain d2hj9c1: 2hj9 C:52-270

Lineage for d2hj9c1 (2hj9 C:52-270)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.6: Sensory domain-like [103190] (3 families)
   alpha(2)-beta(2)-alpha(2)-beta(3); possibly related to the PAS domain

5. Family d.110.6.3: LuxQ-periplasmic domain-like [160679] (1 protein)
   Pfam PF09308; two-domain arrangement similar to the YkuI C-terminal domain-like

6. Protein Autoinducer 2 sensor kinase/phosphatase LuxQ [160680] (1 species)

7. Species Vibrio harveyi [TaxId:669] [160681] (3 PDB entries)
   Uniprot P54302 51-271! Uniprot P54302 52-270

8. Domain d2hj9c1: 2hj9 C:52-270 [145395]
   Other proteins in same PDB: d2hj9a1, d2hj9b1
   the second PAS-domain is partly disordered in the crystal
   complexed with ai2

Details for d2hj9c1

PDB Entry: 2hj9, 2.34 Å

PDB Description: Crystal structure of the Autoinducer-2-bound form of Vibrio harveyi LuxP complexed with the periplasmic domain of LuxQ

PDB Compounds: (C:) Autoinducer 2 sensor kinase/phosphatase luxQ

SCOP Domain Sequences for d2hj9c1:

Sequence, based on SEQRES records:

>d2hj9c1 d.110.6.3 (C:52-270) Autoinducer 2 sensor kinase/phosphatase LuxQ {Vibrio harveyi [TaxId: 669]}
skqqtsalihnifdshfaaiqihhdsnsksevirdfytdrdtdvlnffflsidqsdpsht
pefrfltdhkgiiwddgnahfygvndlildslanrvsfsnnwyyinvmtsigsrhmlvrr
vpildpstgevlgfsfnavvldnnfalmeklksesnvdnvvlvansvplansligdepyn
vadvlqrkssdkrldkllvietpivvnavttelclltvq

Sequence, based on observed residues (ATOM records):

>d2hj9c1 d.110.6.3 (C:52-270) Autoinducer 2 sensor kinase/phosphatase LuxQ {Vibrio harveyi [TaxId: 669]}
skqqtsalihnifdshfaaiqihhdsnsksevirdfytdrdtdvlnffflsidqsdpsht
pefrfltdhkgiiwddgnahfygvndlildslanrvsfsnnwyyinvmtsigsrhmlvrr
vpildpstgevlgfsfnavvldnnfalmeklksesnvdnvvlvansvplansligdepyn
vadvlqrllvietpivvnavttelclltvq

Timeline for d2hj9c1:

• d2hj9c1 is new in SCOP 1.75
  
• d2hj9c1 appears in SCOPe 2.01
  
• d2hj9c1 appears in the current release, SCOPe 2.08