Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.188: Prokaryotic ribosomal protein L17 [64262] (1 superfamily) alpha-beta-alpha(3)-beta(2); 2 layers: alpha/beta; |
Superfamily d.188.1: Prokaryotic ribosomal protein L17 [64263] (1 family) some topological similarity to ribosomal protein L22 |
Family d.188.1.1: Prokaryotic ribosomal protein L17 [64264] (1 protein) |
Protein Prokaryotic ribosomal protein L17 [64265] (4 species) |
Species Thermus thermophilus [TaxId:274] [64266] (11 PDB entries) |
Domain d2hguq1: 2hgu Q:14-118 [145384] Other proteins in same PDB: d2hgu11, d2hgu21, d2hgu31, d2hgu41, d2hgu51, d2hgu61, d2hgu71, d2hgu81, d2hguc1, d2hgud1, d2hgud2, d2hgue1, d2hguf1, d2hgug1, d2hguh1, d2hguh2, d2hguk1, d2hguk2, d2hgul1, d2hgul2, d2hgum1, d2hgun1, d2hguo1, d2hgup1, d2hgur1, d2hgut1, d2hguu1, d2hguv1, d2hguw1, d2hgux1, d2hguy1 automatically matched to d1gd8a_ protein/RNA complex |
PDB Entry: 2hgu (more details), 4.51 Å
SCOPe Domain Sequences for d2hguq1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hguq1 d.188.1.1 (Q:14-118) Prokaryotic ribosomal protein L17 {Thermus thermophilus [TaxId: 274]} sshrlalyrnqaksllthgritttvpkakelrgfvdhlihlakrgdlharrlvlrdlqdv klvrklfdeiapryrdrqggytrvlklaerrrgdgaplalvelve
Timeline for d2hguq1:
View in 3D Domains from other chains: (mouse over for more information) d2hgu11, d2hgu21, d2hgu31, d2hgu41, d2hgu51, d2hgu61, d2hgu71, d2hgu81, d2hguc1, d2hgud1, d2hgud2, d2hgue1, d2hguf1, d2hgug1, d2hguh1, d2hguh2, d2hguk1, d2hguk2, d2hgul1, d2hgul2, d2hgum1, d2hgun1, d2hguo1, d2hgup1, d2hgur1, d2hgut1, d2hguu1, d2hguv1, d2hguw1, d2hgux1, d2hguy1 |