Lineage for d2hgul2 (2hgu L:2-68)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2553569Fold d.47: Ribosomal L11/L12e N-terminal domain [54746] (1 superfamily)
    beta-alpha(2)-beta(2); 2 layers, alpha/beta; antiparallel beta-sheet: order 123
  4. 2553570Superfamily d.47.1: Ribosomal L11/L12e N-terminal domain [54747] (1 family) (S)
  5. 2553571Family d.47.1.1: Ribosomal L11/L12e N-terminal domain [54748] (2 proteins)
    Pfam PF03946
  6. 2553575Protein Ribosomal protein L11, N-terminal domain [54749] (4 species)
  7. 2553614Species Thermus thermophilus [TaxId:274] [160200] (17 PDB entries)
    Uniprot P36238 1-70! Uniprot P36238 2-68! Uniprot P36238 2-70
  8. 2553633Domain d2hgul2: 2hgu L:2-68 [145379]
    Other proteins in same PDB: d2hgu11, d2hgu21, d2hgu31, d2hgu41, d2hgu51, d2hgu61, d2hgu71, d2hgu81, d2hguc1, d2hgud1, d2hgud2, d2hgue1, d2hguf1, d2hgug1, d2hguh1, d2hguh2, d2hguk1, d2hguk2, d2hgul1, d2hgum1, d2hgun1, d2hguo1, d2hgup1, d2hguq1, d2hgur1, d2hgut1, d2hguu1, d2hguv1, d2hguw1, d2hgux1, d2hguy1
    protein/RNA complex
    protein/RNA complex

Details for d2hgul2

PDB Entry: 2hgu (more details), 4.51 Å

PDB Description: 70S T.Th. ribosome functional complex with mRNA and E- and P-site tRNAs at 4.5A. This entry 2HGU contains 50S ribosomal subunit. The 30S ribosomal subunit can be found in PDB entry 2HGR.
PDB Compounds: (L:) 50S ribosomal protein L11

SCOPe Domain Sequences for d2hgul2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hgul2 d.47.1.1 (L:2-68) Ribosomal protein L11, N-terminal domain {Thermus thermophilus [TaxId: 274]}
kkvvavvklqlpagkatpappvgpalgqhganimefvkafnaatanmgdaivpveitiya
drsftfv

SCOPe Domain Coordinates for d2hgul2:

Click to download the PDB-style file with coordinates for d2hgul2.
(The format of our PDB-style files is described here.)

Timeline for d2hgul2: