Lineage for d2hgu51 (2hgu 5:9-53)

  1. Root: SCOPe 2.03
  2. 1458801Class g: Small proteins [56992] (90 folds)
  3. 1464002Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 1464553Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (8 families) (S)
  5. 1464754Family g.41.8.6: Ribosomal protein L33p [144203] (1 protein)
    Pfam PF00471; corresponds structurally and functionally to the ribosomal L44e from eukaryota and archaea; metal ion-binding site is lost in most members
  6. 1464755Protein Ribosomal protein L33p [144204] (3 species)
  7. 1464773Species Thermus thermophilus [TaxId:274] [161180] (9 PDB entries)
    Uniprot P35871 8-52
  8. 1464782Domain d2hgu51: 2hgu 5:9-53 [145365]
    Other proteins in same PDB: d2hgu11, d2hgu21, d2hgu31, d2hgu41, d2hgu61, d2hgu71, d2hgu81, d2hguc1, d2hgud1, d2hgud2, d2hgue1, d2hguf1, d2hgug1, d2hguh1, d2hguh2, d2hguk1, d2hguk2, d2hgul1, d2hgul2, d2hgum1, d2hgun1, d2hguo1, d2hgup1, d2hguq1, d2hgur1, d2hgut1, d2hguu1, d2hguv1, d2hguw1, d2hgux1, d2hguy1
    automatically matched to 2J01 6:9-53
    protein/RNA complex

Details for d2hgu51

PDB Entry: 2hgu (more details), 4.51 Å

PDB Description: 70S T.Th. ribosome functional complex with mRNA and E- and P-site tRNAs at 4.5A. This entry 2HGU contains 50S ribosomal subunit. The 30S ribosomal subunit can be found in PDB entry 2HGR.
PDB Compounds: (5:) 50S ribosomal protein L33

SCOPe Domain Sequences for d2hgu51:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hgu51 g.41.8.6 (5:9-53) Ribosomal protein L33p {Thermus thermophilus [TaxId: 274]}
lllecteckrrnyateknkrntpnklelrkycpwcrkhtvhrevk

SCOPe Domain Coordinates for d2hgu51:

Click to download the PDB-style file with coordinates for d2hgu51.
(The format of our PDB-style files is described here.)

Timeline for d2hgu51: