Lineage for d2hgqx1 (2hgq X:2-102)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 796060Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 796588Superfamily b.34.5: Translation proteins SH3-like domain [50104] (7 families) (S)
    many known members contain KOW motif
  5. 796589Family b.34.5.1: Ribosomal proteins L24p and L21e [50105] (2 proteins)
  6. 796632Protein Ribosomal proteins L24 (L24p) [50106] (4 species)
  7. 796717Species Thermus thermophilus [TaxId:274] [159025] (11 PDB entries)
    Uniprot Q72I15 2-102
  8. 796725Domain d2hgqx1: 2hgq X:2-102 [145358]
    Other proteins in same PDB: d2hgq11, d2hgq21, d2hgq31, d2hgq41, d2hgq51, d2hgq61, d2hgq71, d2hgq81, d2hgqc1, d2hgqd1, d2hgqd2, d2hgqe1, d2hgqf1, d2hgqg1, d2hgqh1, d2hgqh2, d2hgqk1, d2hgqk2, d2hgql1, d2hgql2, d2hgqm1, d2hgqn1, d2hgqo1, d2hgqp1, d2hgqq1, d2hgqr1, d2hgqt1, d2hgqu1, d2hgqv1, d2hgqw1, d2hgqy1
    automatically matched to 2J01 Y:2-102

Details for d2hgqx1

PDB Entry: 2hgq (more details), 5.5 Å

PDB Description: Crystal structure of the 70S Thermus thermophilus ribosome with translocated and rotated Shine-Dalgarno Duplex. This entry 2HGQ contains 50S ribosomal subunit. The 30S ribosomal subunit can be found in PDB entry 2HGP.
PDB Compounds: (X:) 50S ribosomal protein L24

SCOP Domain Sequences for d2hgqx1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hgqx1 b.34.5.1 (X:2-102) Ribosomal proteins L24 (L24p) {Thermus thermophilus [TaxId: 274]}
rvkmhvkkgdtvlvasgkykgrvgkvkevlpkkyavivegvnivkkavrvspkypqggfi
ekeaplhaskvrpicpacgkptrvrkkflengkkirvcakc

SCOP Domain Coordinates for d2hgqx1:

Click to download the PDB-style file with coordinates for d2hgqx1.
(The format of our PDB-style files is described here.)

Timeline for d2hgqx1: