SCOPe 2.02: Domain d2hgqd2: 2hgq D:5-126

Lineage for d2hgqd2 (2hgq D:5-126)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families)

5. Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins)
   barrel, closed; n=5, S=8

6. Protein N-terminal domain of ribosomal protein L2 [50299] (5 species)
   incomplete OB-fold lacking the last strand

7. Species Thermus thermophilus [TaxId:274] [159084] (6 PDB entries)
   Uniprot Q72I07 1-125

8. Domain d2hgqd2: 2hgq D:5-126 [145338]
   Other proteins in same PDB: d2hgq11, d2hgq21, d2hgq31, d2hgq41, d2hgq51, d2hgq61, d2hgq71, d2hgq81, d2hgqc1, d2hgqd1, d2hgqe1, d2hgqf1, d2hgqg1, d2hgqh1, d2hgqh2, d2hgqk1, d2hgqk2, d2hgql1, d2hgql2, d2hgqm1, d2hgqn1, d2hgqo1, d2hgqp1, d2hgqq1, d2hgqr1, d2hgqt1, d2hgqu1, d2hgqv1, d2hgqw1, d2hgqx1, d2hgqy1
   automatically matched to 2J01 D:2-126

Details for d2hgqd2

PDB Entry: 2hgq, 5.5 Å

PDB Description: Crystal structure of the 70S Thermus thermophilus ribosome with translocated and rotated Shine-Dalgarno Duplex. This entry 2HGQ contains 50S ribosomal subunit. The 30S ribosomal subunit can be found in PDB entry 2HGP.

PDB Compounds: (D:) 50S ribosomal protein L2

SCOPe Domain Sequences for d2hgqd2:

Sequence; same for both SEQRES and ATOM records:

>d2hgqd2 b.40.4.5 (D:5-126) N-terminal domain of ribosomal protein L2 {Thermus thermophilus [TaxId: 274]}
kfkpytpsrrfmtvadfseitktepekslvkplkktggrnnqgritvrfrggghkrlyri
idfkrwdkvgipakvaaieydpnrsariallhyvdgekryiiapdglqvgqqvvagpdap
iq

Timeline for d2hgqd2:

• d2hgqd2 first appeared in SCOP 1.75
  
• d2hgqd2 appears in SCOPe 2.01
  
• d2hgqd2 appears in SCOPe 2.03
  
• d2hgqd2 appears in the current release, SCOPe 2.08