SCOP 1.75: Domain d2hgju1: 2hgj U:1-101

Lineage for d2hgju1 (2hgj U:1-101)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.155: L21p-like [141090] (1 superfamily)
   core: sandwich, 6 strands in 2 sheets

4. Superfamily b.155.1: L21p-like [141091] (1 family)

5. Family b.155.1.1: Ribosomal protein L21p [141092] (1 protein)
   Pfam PF00829

6. Protein Ribosomal protein L21p [141093] (3 species)

7. Species Thermus thermophilus [TaxId:274] [158939] (11 PDB entries)
   Uniprot P60492 1-101

8. Domain d2hgju1: 2hgj U:1-101 [145323]
   Other proteins in same PDB: d2hgj11, d2hgj21, d2hgj31, d2hgj41, d2hgj51, d2hgj61, d2hgj71, d2hgj81, d2hgjc1, d2hgjd1, d2hgjd2, d2hgje1, d2hgjf1, d2hgjg1, d2hgjh1, d2hgjh2, d2hgjk1, d2hgjk2, d2hgjl1, d2hgjl2, d2hgjm1, d2hgjn1, d2hgjo1, d2hgjp1, d2hgjq1, d2hgjr1, d2hgjt1, d2hgjv1, d2hgjw1, d2hgjx1, d2hgjy1
   Representative structure

Details for d2hgju1

PDB Entry: 2hgj, 5 Å

PDB Description: Crystal structure of the 70S Thermus thermophilus ribosome showing how the 16S 3'-end mimicks mRNA E and P codons. This entry 2HGJ contains 50S ribosomal subunit. The 30S ribosomal subunit can be found in PDB entry 2HGI.

PDB Compounds: (U:) 50S ribosomal protein L21

SCOP Domain Sequences for d2hgju1:

Sequence; same for both SEQRES and ATOM records:

>d2hgju1 b.155.1.1 (U:1-101) Ribosomal protein L21p {Thermus thermophilus [TaxId: 274]}
mfaivktggkqyrvepglklrvekldaepgatvelpvlllggektvvgtpvvegasvvae
vlghgrgkkilvskfkakvqyrrkkghrqpytellikeirg

Timeline for d2hgju1:

• d2hgju1 is new in SCOP 1.75
  
• d2hgju1 appears in SCOPe 2.01
  
• d2hgju1 appears in the current release, SCOPe 2.08