Lineage for d2hgjp1 (2hgj P:6-141)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2551902Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. 2552181Superfamily d.41.4: Ribosomal protein L16p/L10e [54686] (2 families) (S)
  5. 2552246Family d.41.4.2: Ribosomal protein L16p [117888] (1 protein)
    Pfam PF00252
  6. 2552247Protein Ribosomal protein L16p [117889] (4 species)
  7. 2552287Species Thermus thermophilus [TaxId:274] [160197] (5 PDB entries)
  8. 2552291Domain d2hgjp1: 2hgj P:6-141 [145319]
    Other proteins in same PDB: d2hgj11, d2hgj21, d2hgj31, d2hgj41, d2hgj51, d2hgj61, d2hgj71, d2hgj81, d2hgjc1, d2hgjd1, d2hgjd2, d2hgje1, d2hgjf1, d2hgjg1, d2hgjh1, d2hgjh2, d2hgjk1, d2hgjk2, d2hgjl1, d2hgjl2, d2hgjm1, d2hgjn1, d2hgjo1, d2hgjq1, d2hgjr1, d2hgjt1, d2hgju1, d2hgjv1, d2hgjw1, d2hgjx1, d2hgjy1

Details for d2hgjp1

PDB Entry: 2hgj (more details), 5 Å

PDB Description: Crystal structure of the 70S Thermus thermophilus ribosome showing how the 16S 3'-end mimicks mRNA E and P codons. This entry 2HGJ contains 50S ribosomal subunit. The 30S ribosomal subunit can be found in PDB entry 2HGI.
PDB Compounds: (P:) 50S ribosomal protein L16

SCOPe Domain Sequences for d2hgjp1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hgjp1 d.41.4.2 (P:6-141) Ribosomal protein L16p {Thermus thermophilus [TaxId: 274]}
rmkyrkqqrgrlkgatkggdyvafgdyglvalepawitaqqieaarvamvrhfrrggkif
irifpdkpytkkplevrmgkgkgnvegyvavvkpgrvmfevagvteeqamealriaghkl
piktkivrrdaydeaq

SCOPe Domain Coordinates for d2hgjp1:

Click to download the PDB-style file with coordinates for d2hgjp1.
(The format of our PDB-style files is described here.)

Timeline for d2hgjp1: