Lineage for d2hgjk1 (2hgj K:56-148)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2573816Fold d.99: Ribosomal protein L9 C-domain [55652] (1 superfamily)
    alpha-beta-alpha(2)-beta(2); 2 layers: alpha/beta
  4. 2573817Superfamily d.99.1: Ribosomal protein L9 C-domain [55653] (1 family) (S)
    automatically mapped to Pfam PF03948
  5. 2573818Family d.99.1.1: Ribosomal protein L9 C-domain [55654] (1 protein)
  6. 2573819Protein Ribosomal protein L9 C-domain [55655] (3 species)
  7. 2573852Species Thermus thermophilus [TaxId:274] [143635] (9 PDB entries)
    Uniprot Q5SLQ1 55-146
  8. 2573856Domain d2hgjk1: 2hgj K:56-148 [145312]
    Other proteins in same PDB: d2hgj11, d2hgj21, d2hgj31, d2hgj41, d2hgj51, d2hgj61, d2hgj71, d2hgj81, d2hgjc1, d2hgjd1, d2hgjd2, d2hgje1, d2hgjf1, d2hgjg1, d2hgjh1, d2hgjh2, d2hgjk2, d2hgjl1, d2hgjl2, d2hgjm1, d2hgjn1, d2hgjo1, d2hgjp1, d2hgjq1, d2hgjr1, d2hgjt1, d2hgju1, d2hgjv1, d2hgjw1, d2hgjx1, d2hgjy1

Details for d2hgjk1

PDB Entry: 2hgj (more details), 5 Å

PDB Description: Crystal structure of the 70S Thermus thermophilus ribosome showing how the 16S 3'-end mimicks mRNA E and P codons. This entry 2HGJ contains 50S ribosomal subunit. The 30S ribosomal subunit can be found in PDB entry 2HGI.
PDB Compounds: (K:) 50S ribosomal protein L9

SCOPe Domain Sequences for d2hgjk1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hgjk1 d.99.1.1 (K:56-148) Ribosomal protein L9 C-domain {Thermus thermophilus [TaxId: 274]}
krlaerkaeaerlkkilenltltipvragetkiygsvtakdiaealsrqhgvtidpkrla
lekpikelgeyvltykphpevpiqlkvsvvaqe

SCOPe Domain Coordinates for d2hgjk1:

Click to download the PDB-style file with coordinates for d2hgjk1.
(The format of our PDB-style files is described here.)

Timeline for d2hgjk1: