Lineage for d2hgjh2 (2hgj H:83-171)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2584865Fold d.141: Ribosomal protein L6 [56052] (1 superfamily)
    consists of two beta-sheets and one alpha-helix packed around single core
  4. 2584866Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family) (S)
    automatically mapped to Pfam PF00347
  5. 2584867Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein)
  6. 2584868Protein Ribosomal protein L6 [56055] (6 species)
    duplication: consists of two domains of this fold
  7. 2585023Species Thermus thermophilus [TaxId:274] [160797] (15 PDB entries)
    Uniprot Q72I19 11-81! Uniprot Q72I19 82-170
  8. 2585039Domain d2hgjh2: 2hgj H:83-171 [145311]
    Other proteins in same PDB: d2hgj11, d2hgj21, d2hgj31, d2hgj41, d2hgj51, d2hgj61, d2hgj71, d2hgj81, d2hgjc1, d2hgjd1, d2hgjd2, d2hgje1, d2hgjf1, d2hgjg1, d2hgjk1, d2hgjk2, d2hgjl1, d2hgjl2, d2hgjm1, d2hgjn1, d2hgjo1, d2hgjp1, d2hgjq1, d2hgjr1, d2hgjt1, d2hgju1, d2hgjv1, d2hgjw1, d2hgjx1, d2hgjy1

Details for d2hgjh2

PDB Entry: 2hgj (more details), 5 Å

PDB Description: Crystal structure of the 70S Thermus thermophilus ribosome showing how the 16S 3'-end mimicks mRNA E and P codons. This entry 2HGJ contains 50S ribosomal subunit. The 30S ribosomal subunit can be found in PDB entry 2HGI.
PDB Compounds: (H:) 50S ribosomal protein L6

SCOPe Domain Sequences for d2hgjh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hgjh2 d.141.1.1 (H:83-171) Ribosomal protein L6 {Thermus thermophilus [TaxId: 274]}
yskellikgigyrarlvgraleltvgfshpvvveppegitfevpeptrvrvsgidkqkvg
qvaanirairkpsayhekgiyyagepvrl

SCOPe Domain Coordinates for d2hgjh2:

Click to download the PDB-style file with coordinates for d2hgjh2.
(The format of our PDB-style files is described here.)

Timeline for d2hgjh2: