Lineage for d2hgj11 (2hgj 1:1-67)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2303207Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 2303233Superfamily a.2.2: Ribosomal protein L29 (L29p) [46561] (1 family) (S)
    automatically mapped to Pfam PF00831
  5. 2303234Family a.2.2.1: Ribosomal protein L29 (L29p) [46562] (1 protein)
  6. 2303235Protein Ribosomal protein L29 (L29p) [46563] (5 species)
  7. 2303319Species Thermus thermophilus [TaxId:274] [140100] (10 PDB entries)
    Uniprot Q5SHP6 12-62
  8. 2303323Domain d2hgj11: 2hgj 1:1-67 [145297]
    Other proteins in same PDB: d2hgj21, d2hgj31, d2hgj41, d2hgj51, d2hgj61, d2hgj71, d2hgj81, d2hgjc1, d2hgjd1, d2hgjd2, d2hgje1, d2hgjf1, d2hgjg1, d2hgjh1, d2hgjh2, d2hgjk1, d2hgjk2, d2hgjl1, d2hgjl2, d2hgjm1, d2hgjn1, d2hgjo1, d2hgjp1, d2hgjq1, d2hgjr1, d2hgjt1, d2hgju1, d2hgjv1, d2hgjw1, d2hgjx1, d2hgjy1

Details for d2hgj11

PDB Entry: 2hgj (more details), 5 Å

PDB Description: Crystal structure of the 70S Thermus thermophilus ribosome showing how the 16S 3'-end mimicks mRNA E and P codons. This entry 2HGJ contains 50S ribosomal subunit. The 30S ribosomal subunit can be found in PDB entry 2HGI.
PDB Compounds: (1:) 50S ribosomal protein L29

SCOPe Domain Sequences for d2hgj11:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hgj11 a.2.2.1 (1:1-67) Ribosomal protein L29 (L29p) {Thermus thermophilus [TaxId: 274]}
mrkqleearklspveleklvrekkrelmelrfqasigqlsqnhkirdlkrqiarlltvln
ekrrqna

SCOPe Domain Coordinates for d2hgj11:

Click to download the PDB-style file with coordinates for d2hgj11.
(The format of our PDB-style files is described here.)

Timeline for d2hgj11: