SCOP 1.75: Domain d2hg5c1: 2hg5 C:22-78

Lineage for d2hg5c1 (2hg5 C:22-78)

1. Root: SCOP 1.75

2. Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)

3. Fold f.14: Voltage-gated potassium channels [81325] (1 superfamily)
   oligomeric transmembrane alpha-helical proteins

4. Superfamily f.14.1: Voltage-gated potassium channels [81324] (1 family)

5. Family f.14.1.1: Voltage-gated potassium channels [81323] (5 proteins)

6. Protein Potassium channel protein [56901] (2 species)

7. Species Streptomyces coelicolor [TaxId:1902] [56902] (28 PDB entries)
   identical sequence to Streptomyces lividans, TaxId: 1916
   Uniprot Q54397 22-124

8. Domain d2hg5c1: 2hg5 C:22-78 [145295]
   automatically matched to 2H8P C:22-78
   complexed with b3h, cs, goa

Details for d2hg5c1

PDB Entry: 2hg5, 2.75 Å

PDB Description: cs+ complex of a k channel with an amide to ester substitution in the selectivity filter

PDB Compounds: (C:) KcsA Channel

SCOP Domain Sequences for d2hg5c1:

Sequence; same for both SEQRES and ATOM records:

>d2hg5c1 f.14.1.1 (C:22-78) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]}
salhwraagaatvllvivllagsylavlaergapgaqlitypralwwacetattvgy

Timeline for d2hg5c1:

• d2hg5c1 is new in SCOP 1.75
  
• d2hg5c1 appears in SCOPe 2.01
  
• d2hg5c1 appears in the current release, SCOPe 2.08