Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (23 families) the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
Family d.3.1.9: Ubiquitin carboxyl-terminal hydrolase, UCH [82568] (6 proteins) Pfam PF00443 |
Protein Ubiquitin carboxyl-terminal hydrolase 2, USP2 [159841] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [159842] (2 PDB entries) Uniprot O75604 263-600! Uniprot O75604 264-599 |
Domain d2hd5a1: 2hd5 A:211-521 [145293] Other proteins in same PDB: d2hd5b_ complexed with zn |
PDB Entry: 2hd5 (more details), 1.85 Å
SCOPe Domain Sequences for d2hd5a1:
Sequence, based on SEQRES records: (download)
>d2hd5a1 d.3.1.9 (A:211-521) Ubiquitin carboxyl-terminal hydrolase 2, USP2 {Human (Homo sapiens) [TaxId: 9606]} qglaglrnlgntcfmnsilqclsntrelrdyclqrlymrdlhhgsnahtalveefakliq tiwtsspndvvspsefktqiqryaprfvgynqqdaqeflrflldglhnevnrvtlrpksn penldhlpddekgrqmwrkyleredsrigdlfvgqlkssltctdcgycstvfdpfwdlsl piakrgypevtlmdcmrlftkedvldgdekptccrcrgrkrcikkfsiqrfpkilvlhlk rfsesrirtsklttfvnfplrdldlrefasentnhavynlyavsnhsgttmgghytaycr spgtgewhtfndssvtpmsssqvrtsdayllfyela
>d2hd5a1 d.3.1.9 (A:211-521) Ubiquitin carboxyl-terminal hydrolase 2, USP2 {Human (Homo sapiens) [TaxId: 9606]} qglaglrnlgntcfmnsilqclsntrelrdyclqrlymrdgsnahtalveefakliqtiw tsspndvvspsefktqiqryaprfvgynqqdaqeflrflldglhnevnrvhlpddekgrq mwrkyleredsrigdlfvgqlkssltctdcgycstvfdpfwdlslpiavtlmdcmrlftk edvldgdekptccrcrgrkrcikkfsiqrfpkilvlhlkrfsesrirtsklttfvnfplr dldlrefasentnhavynlyavsnhsgttmgghytaycrspgtgewhtfndssvtpmsss qvrtsdayllfyela
Timeline for d2hd5a1: