Lineage for d2gyke1 (2gyk E:3-85)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 767347Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 767412Superfamily a.28.2: Colicin E immunity proteins [47345] (1 family) (S)
  5. 767413Family a.28.2.1: Colicin E immunity proteins [47346] (3 proteins)
  6. 767437Protein ImmE9 protein (Im9) [47351] (1 species)
  7. 767438Species Escherichia coli [TaxId:562] [47352] (12 PDB entries)
  8. 767441Domain d2gyke1: 2gyk E:3-85 [145277]
    Other proteins in same PDB: d2gykb1, d2gykf1
    automatically matched to 2GYK A:3-85
    complexed with po4, zn; mutant

Details for d2gyke1

PDB Entry: 2gyk (more details), 1.6 Å

PDB Description: crystal structure of the complex of the colicin e9 dnase domain with a mutant immunity protein, imme9 (d51a)
PDB Compounds: (E:) colicin-e9 immunity protein

SCOP Domain Sequences for d2gyke1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gyke1 a.28.2.1 (E:3-85) ImmE9 protein (Im9) {Escherichia coli [TaxId: 562]}
lkhsisdyteaeflqlvtticnadtsseeelvklvthfeemtehpsgsaliyypkegddd
spsgivntvkqwraangksgfkq

SCOP Domain Coordinates for d2gyke1:

Click to download the PDB-style file with coordinates for d2gyke1.
(The format of our PDB-style files is described here.)

Timeline for d2gyke1: