SCOPe 2.06: Domain d2gybp1: 2gyb P:1-78

Lineage for d2gybp1 (2gyb P:1-78)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.27: Ribosomal protein S16 [54564] (1 superfamily)
   beta(4)-alpha-beta; 2 layers: alpha/beta; mixed beta-sheet, order: 51234

4. Superfamily d.27.1: Ribosomal protein S16 [54565] (1 family)

5. Family d.27.1.1: Ribosomal protein S16 [54566] (1 protein)

6. Protein Ribosomal protein S16 [54567] (3 species)

7. Species Escherichia coli [TaxId:562] [160143] (26 PDB entries)
   Uniprot P0A7T3 1-82

8. Domain d2gybp1: 2gyb P:1-78 [145258]
   Other proteins in same PDB: d2gybb1, d2gybd1, d2gybh1, d2gybi1, d2gybm1, d2gybq1, d2gybs1, d2gybt1
   protein/RNA complex
   protein/RNA complex

Details for d2gybp1

PDB Entry: 2gyb, 15 Å

PDB Description: Structure of the 30S subunit of a SecM-stalled E. coli ribosome complex obtained by fitting atomic models for RNA and protein components into cryo-EM map EMD-1143

PDB Compounds: (P:) 30S ribosomal subunit protein S16

SCOPe Domain Sequences for d2gybp1:

Sequence; same for both SEQRES and ATOM records:

>d2gybp1 d.27.1.1 (P:1-78) Ribosomal protein S16 {Escherichia coli [TaxId: 562]}
mvtirlarhgakkrpfyqvvvadsrnarngrfiervgffnpiasekeegtrldldriahw
vgqgatisdrvaalikev

Timeline for d2gybp1:

• d2gybp1 first appeared in SCOP 1.75
  
• d2gybp1 appears in SCOPe 2.05
  
• d2gybp1 appears in SCOPe 2.07
  
• d2gybp1 appears in the current release, SCOPe 2.08