Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.27: Ribosomal protein S16 [54564] (1 superfamily) beta(4)-alpha-beta; 2 layers: alpha/beta; mixed beta-sheet, order: 51234 |
Superfamily d.27.1: Ribosomal protein S16 [54565] (1 family) |
Family d.27.1.1: Ribosomal protein S16 [54566] (1 protein) |
Protein Ribosomal protein S16 [54567] (3 species) |
Species Escherichia coli [TaxId:562] [160143] (26 PDB entries) Uniprot P0A7T3 1-82 |
Domain d2gybp1: 2gyb P:1-78 [145258] Other proteins in same PDB: d2gybb1, d2gybd1, d2gybh1, d2gybi1, d2gybm1, d2gybq1, d2gybs1, d2gybt1 protein/RNA complex protein/RNA complex |
PDB Entry: 2gyb (more details), 15 Å
SCOPe Domain Sequences for d2gybp1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gybp1 d.27.1.1 (P:1-78) Ribosomal protein S16 {Escherichia coli [TaxId: 562]} mvtirlarhgakkrpfyqvvvadsrnarngrfiervgffnpiasekeegtrldldriahw vgqgatisdrvaalikev
Timeline for d2gybp1: