Class a: All alpha proteins [46456] (289 folds) |
Fold a.156: S13-like H2TH domain [81297] (1 superfamily) core: 3-4 helices |
Superfamily a.156.1: S13-like H2TH domain [46946] (4 families) contains a helix-two turns-helix (H2TH) motif |
Family a.156.1.1: Ribosomal protein S13 [46947] (1 protein) contains 3 helices and a beta-hairpin in the core and a non-globular C-terminal extension automatically mapped to Pfam PF00416 |
Protein Ribosomal protein S13 [46948] (2 species) |
Species Escherichia coli [TaxId:562] [158360] (26 PDB entries) Uniprot P0A7S9 1-114 |
Domain d2gybm1: 2gyb M:1-114 [145257] Other proteins in same PDB: d2gybb1, d2gybd1, d2gybh1, d2gybi1, d2gybp1, d2gybq1, d2gybs1, d2gybt1 protein/RNA complex protein/RNA complex |
PDB Entry: 2gyb (more details), 15 Å
SCOPe Domain Sequences for d2gybm1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gybm1 a.156.1.1 (M:1-114) Ribosomal protein S13 {Escherichia coli [TaxId: 562]} ariaginipdhkhavialtsiygvgktrskailaaagiaedvkiselsegqidtlrdeva kfvvegdlrreismsikrlmdlgcyrglrhrrglpvrgqrtktnartrkgprkp
Timeline for d2gybm1: