Lineage for d2gybm1 (2gyb M:1-114)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2348330Fold a.156: S13-like H2TH domain [81297] (1 superfamily)
    core: 3-4 helices
  4. 2348331Superfamily a.156.1: S13-like H2TH domain [46946] (4 families) (S)
    contains a helix-two turns-helix (H2TH) motif
  5. 2348332Family a.156.1.1: Ribosomal protein S13 [46947] (1 protein)
    contains 3 helices and a beta-hairpin in the core and a non-globular C-terminal extension
    automatically mapped to Pfam PF00416
  6. 2348333Protein Ribosomal protein S13 [46948] (2 species)
  7. 2348334Species Escherichia coli [TaxId:562] [158360] (26 PDB entries)
    Uniprot P0A7S9 1-114
  8. 2348359Domain d2gybm1: 2gyb M:1-114 [145257]
    Other proteins in same PDB: d2gybb1, d2gybd1, d2gybh1, d2gybi1, d2gybp1, d2gybq1, d2gybs1, d2gybt1
    protein/RNA complex
    protein/RNA complex

Details for d2gybm1

PDB Entry: 2gyb (more details), 15 Å

PDB Description: Structure of the 30S subunit of a SecM-stalled E. coli ribosome complex obtained by fitting atomic models for RNA and protein components into cryo-EM map EMD-1143
PDB Compounds: (M:) 30S ribosomal subunit protein S13

SCOPe Domain Sequences for d2gybm1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gybm1 a.156.1.1 (M:1-114) Ribosomal protein S13 {Escherichia coli [TaxId: 562]}
ariaginipdhkhavialtsiygvgktrskailaaagiaedvkiselsegqidtlrdeva
kfvvegdlrreismsikrlmdlgcyrglrhrrglpvrgqrtktnartrkgprkp

SCOPe Domain Coordinates for d2gybm1:

Click to download the PDB-style file with coordinates for d2gybm1.
(The format of our PDB-style files is described here.)

Timeline for d2gybm1: