SCOPe 2.03: Domain d2gybd1: 2gyb D:2-205

Lineage for d2gybd1 (2gyb D:2-205)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.66: Alpha-L RNA-binding motif [55173] (1 superfamily)
   alpha(2)-beta(2)-loop-beta; 2 layers: alpha/beta

4. Superfamily d.66.1: Alpha-L RNA-binding motif [55174] (5 families)
   common motif in otherwise different folds

5. Family d.66.1.2: Ribosomal protein S4 [55178] (1 protein)
   has a RRF/tRNA synthetase additional domain-like fold

6. Protein Ribosomal protein S4 [55179] (3 species)
   also contains a Zn-binding N-terminal subdomain

7. Species Escherichia coli [TaxId:562] [160439] (26 PDB entries)
   Uniprot P0A7V8 1-205

8. Domain d2gybd1: 2gyb D:2-205 [145255]
   Other proteins in same PDB: d2gybb1, d2gybh1, d2gybi1, d2gybm1, d2gybp1, d2gybq1, d2gybs1, d2gybt1
   automatically matched to 2AVY D:1-205
   protein/RNA complex

Details for d2gybd1

PDB Entry: 2gyb, 15 Å

PDB Description: Structure of the 30S subunit of a SecM-stalled E. coli ribosome complex obtained by fitting atomic models for RNA and protein components into cryo-EM map EMD-1143

PDB Compounds: (D:) 30S ribosomal subunit protein S4

SCOPe Domain Sequences for d2gybd1:

Sequence; same for both SEQRES and ATOM records:

>d2gybd1 d.66.1.2 (D:2-205) Ribosomal protein S4 {Escherichia coli [TaxId: 562]}
rylgpklklsrregtdlflksgvraidtkckieqapgqhgarkprlsdygvqlrekqkvr
riygvlerqfrnyykeaarlkgntgenllallegrldnvvyrmgfgatraearqlvshka
imvngrvvniasyqvspndvvsirekakkqsrvkaalelaeqrekptwlevdagkmegtf
krkpersdlsadinehlivelysk

Timeline for d2gybd1:

• d2gybd1 first appeared in SCOP 1.75
  
• d2gybd1 appears in SCOPe 2.02
  
• d2gybd1 appears in SCOPe 2.04
  
• d2gybd1 appears in the current release, SCOPe 2.08