Lineage for d2gybb1 (2gyb B:8-225)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1158036Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1159920Superfamily c.23.15: Ribosomal protein S2 [52313] (1 family) (S)
    fold elaborated with additional structures
  5. 1159921Family c.23.15.1: Ribosomal protein S2 [52314] (1 protein)
  6. 1159922Protein Ribosomal protein S2 [52315] (3 species)
  7. 1159932Species Escherichia coli [TaxId:562] [159491] (26 PDB entries)
    Uniprot P0A7V0 8-225
  8. 1159958Domain d2gybb1: 2gyb B:8-225 [145254]
    Other proteins in same PDB: d2gybd1, d2gybh1, d2gybi1, d2gybm1, d2gybp1, d2gybq1, d2gybs1, d2gybt1
    automatically matched to 2AVY B:8-225
    protein/RNA complex

Details for d2gybb1

PDB Entry: 2gyb (more details), 15 Å

PDB Description: Structure of the 30S subunit of a SecM-stalled E. coli ribosome complex obtained by fitting atomic models for RNA and protein components into cryo-EM map EMD-1143
PDB Compounds: (B:) 30S ribosomal subunit protein S2

SCOPe Domain Sequences for d2gybb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gybb1 c.23.15.1 (B:8-225) Ribosomal protein S2 {Escherichia coli [TaxId: 562]}
mlkagvhfghqtrywnpkmkpfifgarnkvhiinlektvpmfnealaelnkiasrkgkil
fvgtkraaseavkdaalscdqffvnhrwlggmltnwktvrqsikrlkdletqsqdgtfdk
ltkkealmrtreleklenslggikdmgglpdalfvidadhehiaikeannlgipvfaivd
tnsdpdgvdfvipgnddairavtlylgavaatvregrs

SCOPe Domain Coordinates for d2gybb1:

Click to download the PDB-style file with coordinates for d2gybb1.
(The format of our PDB-style files is described here.)

Timeline for d2gybb1: