![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.27: Ribosomal protein S16 [54564] (1 superfamily) beta(4)-alpha-beta; 2 layers: alpha/beta; mixed beta-sheet, order: 51234 |
![]() | Superfamily d.27.1: Ribosomal protein S16 [54565] (1 family) ![]() |
![]() | Family d.27.1.1: Ribosomal protein S16 [54566] (1 protein) |
![]() | Protein Ribosomal protein S16 [54567] (3 species) |
![]() | Species Escherichia coli [TaxId:562] [160143] (26 PDB entries) Uniprot P0A7T3 1-82 |
![]() | Domain d2gy9p1: 2gy9 P:1-78 [145236] Other proteins in same PDB: d2gy9b1, d2gy9d1, d2gy9h1, d2gy9i1, d2gy9m1, d2gy9q1, d2gy9s1, d2gy9t1 automatically matched to 2AVY P:1-82 |
PDB Entry: 2gy9 (more details), 2 Å
SCOP Domain Sequences for d2gy9p1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gy9p1 d.27.1.1 (P:1-78) Ribosomal protein S16 {Escherichia coli [TaxId: 562]} mvtirlarhgakkrpfyqvvvadsrnarngrfiervgffnpiasekeegtrldldriahw vgqgatisdrvaalikev
Timeline for d2gy9p1: