Lineage for d2gy9i1 (2gy9 I:4-129)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 852984Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 852985Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (12 families) (S)
  5. 852986Family d.14.1.1: Translational machinery components [54212] (4 proteins)
  6. 853092Protein Ribosomal protein S9 [54218] (2 species)
  7. 853093Species Escherichia coli [TaxId:562] [159907] (26 PDB entries)
    Uniprot P0A7X3 3-129
  8. 853094Domain d2gy9i1: 2gy9 I:4-129 [145234]
    Other proteins in same PDB: d2gy9b1, d2gy9d1, d2gy9h1, d2gy9m1, d2gy9p1, d2gy9q1, d2gy9s1, d2gy9t1
    automatically matched to 2AVY I:3-129

Details for d2gy9i1

PDB Entry: 2gy9 (more details), 2 Å

PDB Description: Structure of the 30S subunit of a pre-translocational E. coli ribosome obtained by fitting atomic models for RNA and protein components into cryo-EM map EMD-1056
PDB Compounds: (I:) 30S ribosomal subunit protein S9

SCOP Domain Sequences for d2gy9i1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gy9i1 d.14.1.1 (I:4-129) Ribosomal protein S9 {Escherichia coli [TaxId: 562]}
qyygtgrrkssaarvfikpgngkivinqrsleqyfgretarmvvrqplelvdmvekldly
itvkgggisgqagairhgitralmeydeslrselrkagfvtrdarqverkkvglrkarrr
pqfskr

SCOP Domain Coordinates for d2gy9i1:

Click to download the PDB-style file with coordinates for d2gy9i1.
(The format of our PDB-style files is described here.)

Timeline for d2gy9i1: