Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (7 species) |
Species Mouse (Mus musculus) [TaxId:10090] [88576] (373 PDB entries) Uniprot P01864 # GCAB_MOUSE Ig gamma-2A chain C region secreted form (B allele) ! Uniprot P01863 #GCAA_MOUSE Ig gamma-2A chain C region, A allele; 86% sequence identity ! SQ NA # natural chimera; best hits are: Uniprot P01751 (Ig heavy chain V region B1-8/186-2) and Uniprot P01864 (Ig gamma-2A chain C region secreted form) ! Uniprot P01868 # GC1_MOUSE Ig gamma-1 chain C region secreted form ! Uniprot P01864 # GCAB_MOUSE (P01864) Ig gamma-2A chain C region ! Uniprot P01837 # KAC_MOUSE (P01837) Ig kappa chain C region ! Uniprot P01863 # GCAA_MOUSE Ig gamma-2A chain C region, A allele ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01868 # ! GC1_MOUSE Ig gamma-1 chain C region secreted form |
Domain d2gsih2: 2gsi H:115-228 [145228] Other proteins in same PDB: d2gsia1, d2gsia2, d2gsib1, d2gsic1, d2gsic2, d2gsid1, d2gsie1, d2gsie2, d2gsif1, d2gsig1, d2gsig2, d2gsih1 automatically matched to 2GSI B:115-228 complexed with na |
PDB Entry: 2gsi (more details), 2.81 Å
SCOPe Domain Sequences for d2gsih2:
Sequence, based on SEQRES records: (download)
>d2gsih2 b.1.1.2 (H:115-228) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]} kttppsvyplapgtaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdl ytlsssvtvpsstwpsqtvtcnvahpasstkvdkkivpr
>d2gsih2 b.1.1.2 (H:115-228) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]} kttppsvyplapmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsssvt vpsstwpsqtvtcnvahpasstkvdkkivpr
Timeline for d2gsih2: