SCOPe 2.04: Domain d2gmrl1: 2gmr L:1-280

Lineage for d2gmrl1 (2gmr L:1-280)

1. Root: SCOPe 2.04

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)
   automatically mapped to Pfam PF00124

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
   L and M are probably related to each other

6. Protein L (light) subunit [81477] (3 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [81475] (61 PDB entries)
   Uniprot P02954

8. Domain d2gmrl1: 2gmr L:1-280 [145219]
   Other proteins in same PDB: d2gmrh1, d2gmrh2, d2gmrm_
   complexed with bcl, bph, fe2, lda, spn, u10; mutant

Details for d2gmrl1

PDB Entry: 2gmr, 2.5 Å

PDB Description: photosynthetic reaction center mutant from rhodobacter sphaeroides with asp l210 replaced with asn

PDB Compounds: (L:) Photosynthetic Reaction center protein L chain

SCOPe Domain Sequences for d2gmrl1:

Sequence; same for both SEQRES and ATOM records:

>d2gmrl1 f.26.1.1 (L:1-280) L (light) subunit {Rhodobacter sphaeroides [TaxId: 1063]}
allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn
pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa
fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff
ftnalalalhgalvlsaanpekgkemrtpnhedtffrdlvgysigtlgihrlglllslsa
vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipggin

Timeline for d2gmrl1:

• d2gmrl1 first appeared in SCOP 1.75
  
• d2gmrl1 appears in SCOPe 2.03
  
• d2gmrl1 appears in SCOPe 2.05
  
• d2gmrl1 appears in the current release, SCOPe 2.08