Lineage for d2gmrl1 (2gmr L:1-280)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2579766Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 2579767Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
    automatically mapped to Pfam PF00124
  5. 2579768Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
    L and M are probably related to each other
  6. 2579769Protein L (light) subunit [81477] (3 species)
  7. 2579770Species Rhodobacter sphaeroides [TaxId:1063] [81475] (62 PDB entries)
    Uniprot P02954
  8. 2579787Domain d2gmrl1: 2gmr L:1-280 [145219]
    Other proteins in same PDB: d2gmrh1, d2gmrh2, d2gmrm_
    complexed with bcl, bph, fe2, lda, spn, u10; mutant

Details for d2gmrl1

PDB Entry: 2gmr (more details), 2.5 Å

PDB Description: photosynthetic reaction center mutant from rhodobacter sphaeroides with asp l210 replaced with asn
PDB Compounds: (L:) Photosynthetic Reaction center protein L chain

SCOPe Domain Sequences for d2gmrl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gmrl1 f.26.1.1 (L:1-280) L (light) subunit {Rhodobacter sphaeroides [TaxId: 1063]}
allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn
pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa
fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff
ftnalalalhgalvlsaanpekgkemrtpnhedtffrdlvgysigtlgihrlglllslsa
vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipggin

SCOPe Domain Coordinates for d2gmrl1:

Click to download the PDB-style file with coordinates for d2gmrl1.
(The format of our PDB-style files is described here.)

Timeline for d2gmrl1: