Lineage for d2gmia1 (2gmi A:1-152)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 857031Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 857032Superfamily d.20.1: UBC-like [54495] (4 families) (S)
  5. 857033Family d.20.1.1: UBC-related [54496] (6 proteins)
  6. 857041Protein Ubiquitin conjugating enzyme, UBC [54497] (32 species)
  7. 857050Species Baker's yeast (Saccharomyces cerevisiae), ubc13 [TaxId:4932] [64239] (3 PDB entries)
  8. 857054Domain d2gmia1: 2gmi A:1-152 [145218]
    Other proteins in same PDB: d2gmic1
    mutant

Details for d2gmia1

PDB Entry: 2gmi (more details), 2.5 Å

PDB Description: Mms2/Ubc13~Ubiquitin
PDB Compounds: (A:) Ubiquitin-conjugating enzyme E2 13

SCOP Domain Sequences for d2gmia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gmia1 d.20.1.1 (A:1-152) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc13 [TaxId: 4932]}
maslpkriiketeklvsdpvpgitaephddnlryfqvtiegpeqspyedgifelelylpd
dypmeapkvrfltkiyhpnidrlgrisldvlktnwspalqirtvllsiqallaspnpndp
landvaedwikneqgakakarewtklyakkkp

SCOP Domain Coordinates for d2gmia1:

Click to download the PDB-style file with coordinates for d2gmia1.
(The format of our PDB-style files is described here.)

Timeline for d2gmia1: