Lineage for d2gk1e1 (2gk1 E:167-528)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2093018Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2094982Family c.1.8.6: beta-N-acetylhexosaminidase catalytic domain [51550] (6 proteins)
    Glycosyl hydrolase family 20, GH20
    automatically mapped to Pfam PF00728
  6. 2094989Protein beta-hexosaminidase A [159387] (1 species)
  7. 2094990Species Human (Homo sapiens) [TaxId:9606] [159388] (2 PDB entries)
    Uniprot P06865 167-528
  8. 2094997Domain d2gk1e1: 2gk1 E:167-528 [145214]
    Other proteins in same PDB: d2gk1a2, d2gk1b1, d2gk1b2, d2gk1c2, d2gk1d1, d2gk1d2, d2gk1e2, d2gk1f1, d2gk1f2, d2gk1g2, d2gk1h1, d2gk1h2
    automatically matched to 2GJX A:167-528
    complexed with ngt

Details for d2gk1e1

PDB Entry: 2gk1 (more details), 3.25 Å

PDB Description: x-ray crystal structure of ngt-bound hexa
PDB Compounds: (E:) Beta-hexosaminidase alpha chain

SCOPe Domain Sequences for d2gk1e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gk1e1 c.1.8.6 (E:167-528) beta-hexosaminidase A {Human (Homo sapiens) [TaxId: 9606]}
fphrgllldtsrhylplssildtldvmaynklnvfhwhlvddpsfpyesftfpelmrkgs
ynpvthiytaqdvkevieyarlrgirvlaefdtpghtlswgpgipglltpcysgsepsgt
fgpvnpslnntyefmstfflevssvfpdfylhlggdevdftcwksnpeiqdfmrkkgfge
dfkqlesfyiqtlldivssygkgyvvwqevfdnkvkiqpdtiiqvwredipvnymkelel
vtkagfrallsapwylnrisygpdwkdfyvveplafegtpeqkalviggeacmwgeyvdn
tnlvprlwpragavaerlwsnkltsdltfayerlshfrcellrrgvqaqplnvgfceqef
eq

SCOPe Domain Coordinates for d2gk1e1:

Click to download the PDB-style file with coordinates for d2gk1e1.
(The format of our PDB-style files is described here.)

Timeline for d2gk1e1: