![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
![]() | Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (4 families) ![]() contains similar fold but lacks its catalytic centre |
![]() | Family d.92.2.1: beta-N-acetylhexosaminidase domain [55546] (4 proteins) family GH20 |
![]() | Protein beta-hexosaminidase A [160560] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [160561] (2 PDB entries) Uniprot P06865 23-166 |
![]() | Domain d2gk1a2: 2gk1 A:23-166 [145211] Other proteins in same PDB: d2gk1a1, d2gk1b1, d2gk1b2, d2gk1c1, d2gk1d1, d2gk1d2, d2gk1e1, d2gk1f1, d2gk1f2, d2gk1g1, d2gk1h1, d2gk1h2 automatically matched to 2GJX A:23-166 complexed with ngt |
PDB Entry: 2gk1 (more details), 3.25 Å
SCOPe Domain Sequences for d2gk1a2:
Sequence, based on SEQRES records: (download)
>d2gk1a2 d.92.2.1 (A:23-166) beta-hexosaminidase A {Human (Homo sapiens) [TaxId: 9606]} lwpwpqnfqtsdqryvlypnnfqfqydvssaaqpgcsvldeafqryrdllfgsgswprpy ltgkrhtleknvlvvsvvtpgcnqlptlesvenytltinddqclllsetvwgalrgletf sqlvwksaegtffinkteiedfpr
>d2gk1a2 d.92.2.1 (A:23-166) beta-hexosaminidase A {Human (Homo sapiens) [TaxId: 9606]} lwpwpqnfqtsdqryvlypnnfqfqydvssaaqpgcsvldeafqryrdllfgtleknvlv vsvvtpgcnqlptlesvenytltinddqclllsetvwgalrgletfsqlvwksaegtffi nkteiedfpr
Timeline for d2gk1a2: