Lineage for d2gjxe2 (2gjx E:23-166)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2204982Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2206336Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (4 families) (S)
    contains similar fold but lacks its catalytic centre
  5. 2206337Family d.92.2.1: beta-N-acetylhexosaminidase domain [55546] (4 proteins)
    family GH20
  6. 2206344Protein beta-hexosaminidase A [160560] (1 species)
  7. 2206345Species Human (Homo sapiens) [TaxId:9606] [160561] (2 PDB entries)
    Uniprot P06865 23-166
  8. 2206348Domain d2gjxe2: 2gjx E:23-166 [145207]
    Other proteins in same PDB: d2gjxa1, d2gjxb1, d2gjxb2, d2gjxc1, d2gjxc2, d2gjxd1, d2gjxe1, d2gjxf1, d2gjxf2, d2gjxg1, d2gjxg2, d2gjxh1
    automated match to d2gjxa2
    complexed with nag, so4

Details for d2gjxe2

PDB Entry: 2gjx (more details), 2.8 Å

PDB Description: crystallographic structure of human beta-hexosaminidase a
PDB Compounds: (E:) Beta-hexosaminidase alpha chain

SCOPe Domain Sequences for d2gjxe2:

Sequence, based on SEQRES records: (download)

>d2gjxe2 d.92.2.1 (E:23-166) beta-hexosaminidase A {Human (Homo sapiens) [TaxId: 9606]}
lwpwpqnfqtsdqryvlypnnfqfqydvssaaqpgcsvldeafqryrdllfgsgswprpy
ltgkrhtleknvlvvsvvtpgcnqlptlesvenytltinddqclllsetvwgalrgletf
sqlvwksaegtffinkteiedfpr

Sequence, based on observed residues (ATOM records): (download)

>d2gjxe2 d.92.2.1 (E:23-166) beta-hexosaminidase A {Human (Homo sapiens) [TaxId: 9606]}
lwpwpqnfqtsdqryvlypnnfqfqydvssaaqpgcsvldeafqryrdllfgtleknvlv
vsvvtpgcnqlptlesvenytltinddqclllsetvwgalrgletfsqlvwksaegtffi
nkteiedfpr

SCOPe Domain Coordinates for d2gjxe2:

Click to download the PDB-style file with coordinates for d2gjxe2.
(The format of our PDB-style files is described here.)

Timeline for d2gjxe2: