Lineage for d2g9hd2 (2g9h D:87-216)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1017615Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1018752Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) (S)
  5. 1018753Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (15 proteins)
  6. 1018754Protein Enterotoxin type I [159934] (1 species)
  7. 1018755Species Staphylococcus aureus [TaxId:1280] [159935] (1 PDB entry)
    Uniprot Q52T95 87-216
  8. 1018756Domain d2g9hd2: 2g9h D:87-216 [145189]
    Other proteins in same PDB: d2g9ha1, d2g9ha2, d2g9hb1, d2g9hb2, d2g9hd1
    complexed with dio, epe, so4, zn

Details for d2g9hd2

PDB Entry: 2g9h (more details), 2 Å

PDB Description: crystal structure of staphylococcal enterotoxin i (sei) in complex with a human mhc class ii molecule
PDB Compounds: (D:) extracellular enterotoxin type I

SCOPe Domain Sequences for d2g9hd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g9hd2 d.15.6.1 (D:87-216) Enterotoxin type I {Staphylococcus aureus [TaxId: 1280]}
qylnsarkipinlwvngkhktistdkistnkklvtaqeidvklrrylqeeyniyghnstg
kgkeygykskfysgfnkgkvlfhlndeksfsydlfytgdgvpvsflkiyednkiiesekf
hldveisyvd

SCOPe Domain Coordinates for d2g9hd2:

Click to download the PDB-style file with coordinates for d2g9hd2.
(The format of our PDB-style files is described here.)

Timeline for d2g9hd2: