Class b: All beta proteins [48724] (174 folds) |
Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) |
Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (15 proteins) |
Protein Enterotoxin type I, SEI [159080] (1 species) |
Species Staphylococcus aureus [TaxId:1280] [159081] (1 PDB entry) Uniprot Q52T95 4-86 |
Domain d2g9hd1: 2g9h D:4-86 [145188] Other proteins in same PDB: d2g9ha1, d2g9ha2, d2g9hb1, d2g9hb2, d2g9hd2 complexed with dio, epe, so4, zn |
PDB Entry: 2g9h (more details), 2 Å
SCOPe Domain Sequences for d2g9hd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g9hd1 b.40.2.2 (D:4-86) Enterotoxin type I, SEI {Staphylococcus aureus [TaxId: 1280]} igvgnlrnfytkhdyidlkglidknlpsanqlefstgindlisesnnwdeiskfkgkkld ifgidyngpckskymyggatlsg
Timeline for d2g9hd1:
View in 3D Domains from other chains: (mouse over for more information) d2g9ha1, d2g9ha2, d2g9hb1, d2g9hb2 |