SCOPe 2.03: Domain d2g4dc_: 2g4d C:

Lineage for d2g4dc_ (2g4d C:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (23 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.7: Adenain-like [54054] (6 proteins)
   Pfam PF02902; Ulp1 protease family

6. Protein Sentrin-specific protease 1 [142862] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [142863] (6 PDB entries)
   Uniprot Q9P0U3 419-643

8. Domain d2g4dc_: 2g4d C: [145185]
   Other proteins in same PDB: d2g4db_, d2g4dd_
   automated match to d2g4da1
   mutant

Details for d2g4dc_

PDB Entry: 2g4d, 2.8 Å

PDB Description: crystal structure of human senp1 mutant (c603s) in complex with sumo-1

PDB Compounds: (C:) SENP1 protein

SCOPe Domain Sequences for d2g4dc_:

Sequence; same for both SEQRES and ATOM records:

>d2g4dc_ d.3.1.7 (C:) Sentrin-specific protease 1 {Human (Homo sapiens) [TaxId: 9606]}
qdevlseafrltitrkdiqtlnhlnwlndeiinfymnmlmerskekglpsvhafntffft
klktagyqavkrwtkkvdvfsvdillvpihlgvhwclavvdfrkknityydsmgginnea
crillqylkqesidkkrkefdtngwqlfskksqeipqqmngsdsgmfackyadcitkdrp
inftqqhmpyfrkrmvweilhrkll

Timeline for d2g4dc_:

• d2g4dc_ first appeared in SCOP 1.75, called d2g4dc1
  
• d2g4dc_ appears in SCOPe 2.02
  
• d2g4dc_ appears in SCOPe 2.04
  
• d2g4dc_ appears in the current release, SCOPe 2.08