Lineage for d2g45d_ (2g45 D:)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2264067Fold g.44: RING/U-box [57849] (1 superfamily)
    dimetal(zinc)-bound alpha+beta motif; structurally diverse
  4. 2264068Superfamily g.44.1: RING/U-box [57850] (7 families) (S)
  5. 2264170Family g.44.1.5: Zf-UBP [161204] (4 proteins)
    Pfam PF02148
  6. 2264177Protein Ubiquitin carboxyl-terminal hydrolase 5, UBP5 [161207] (1 species)
  7. 2264178Species Human (Homo sapiens) [TaxId:9606] [161208] (2 PDB entries)
    Uniprot P45974 169-285
  8. 2264180Domain d2g45d_: 2g45 D: [145183]
    Other proteins in same PDB: d2g45b_, d2g45e_
    automated match to d2g43a1
    complexed with cl, zn

Details for d2g45d_

PDB Entry: 2g45 (more details), 1.99 Å

PDB Description: Co-crystal structure of znf ubp domain from the deubiquitinating enzyme isopeptidase T (isot) in complex with ubiquitin
PDB Compounds: (D:) Ubiquitin carboxyl-terminal hydrolase 5

SCOPe Domain Sequences for d2g45d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g45d_ g.44.1.5 (D:) Ubiquitin carboxyl-terminal hydrolase 5, UBP5 {Human (Homo sapiens) [TaxId: 9606]}
vrqvskhafslkqldnparippcgwkcskcdmrenlwlnltdgsilcgrryfdgsggnnh
avehyretgyplavklgtitpdgadvysydeddmvldpslaehlshfgidmlkmqkt

SCOPe Domain Coordinates for d2g45d_:

Click to download the PDB-style file with coordinates for d2g45d_.
(The format of our PDB-style files is described here.)

Timeline for d2g45d_: