![]() | Class g: Small proteins [56992] (98 folds) |
![]() | Fold g.44: RING/U-box [57849] (1 superfamily) dimetal(zinc)-bound alpha+beta motif; structurally diverse |
![]() | Superfamily g.44.1: RING/U-box [57850] (7 families) ![]() |
![]() | Family g.44.1.5: Zf-UBP [161204] (4 proteins) Pfam PF02148 |
![]() | Protein Ubiquitin carboxyl-terminal hydrolase 5, UBP5 [161207] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [161208] (6 PDB entries) Uniprot P45974 169-285 |
![]() | Domain d2g45d_: 2g45 D: [145183] Other proteins in same PDB: d2g45b_, d2g45e_ automated match to d2g43a1 complexed with cl, zn |
PDB Entry: 2g45 (more details), 1.99 Å
SCOPe Domain Sequences for d2g45d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g45d_ g.44.1.5 (D:) Ubiquitin carboxyl-terminal hydrolase 5, UBP5 {Human (Homo sapiens) [TaxId: 9606]} vrqvskhafslkqldnparippcgwkcskcdmrenlwlnltdgsilcgrryfdgsggnnh avehyretgyplavklgtitpdgadvysydeddmvldpslaehlshfgidmlkmqkt
Timeline for d2g45d_: