SCOPe 2.08: Domain d2g3qa1: 2g3q A:1339-1381

Lineage for d2g3qa1 (2g3q A:1339-1381)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
   3 helices; bundle, right-handed twist

4. Superfamily a.5.2: UBA-like [46934] (5 families)

5. Family a.5.2.1: UBA domain [46935] (25 proteins)

6. Protein Endocytic protein Ede1, YBL047C [158358] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [158359] (1 PDB entry)
   Uniprot P34216 1339-1381

8. Domain d2g3qa1: 2g3q A:1339-1381 [145181]
   Other proteins in same PDB: d2g3qb_

Details for d2g3qa1

PDB Entry: 2g3q

PDB Description: solution structure of ede1 uba-ubiquitin complex

PDB Compounds: (A:) Protein YBL047C

SCOPe Domain Sequences for d2g3qa1:

Sequence; same for both SEQRES and ATOM records:

>d2g3qa1 a.5.2.1 (A:1339-1381) Endocytic protein Ede1, YBL047C {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ttpkslaveelsgmgfteeeahnalekcnwdleaatnflldsa

Timeline for d2g3qa1:

• d2g3qa1 first appeared in SCOP 1.75
  
• d2g3qa1 appears in SCOPe 2.07