Lineage for d2fyuk1 (2fyu K:1-53)

  1. Root: SCOP 1.75
  2. 886031Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)
  3. 887128Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 887604Superfamily f.23.15: Subunit XI (6.4 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81518] (1 family) (S)
  5. 887605Family f.23.15.1: Subunit XI (6.4 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81517] (1 protein)
  6. 887606Protein Subunit XI (6.4 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81516] (1 species)
    the smallest subunit of the complex, interacts with subunit 10 and ISP, peripherally located
  7. 887607Species Cow (Bos taurus) [TaxId:9913] [81515] (15 PDB entries)
    Uniprot P07552
  8. 887608Domain d2fyuk1: 2fyu K:1-53 [145179]
    Other proteins in same PDB: d2fyua1, d2fyua2, d2fyub1, d2fyub2, d2fyuc1, d2fyuc2, d2fyud1, d2fyud2, d2fyuf1, d2fyug1, d2fyuh1, d2fyui1, d2fyuj1
    automatically matched to 1SQQ K:1-54
    complexed with fdn, fes, hem

Details for d2fyuk1

PDB Entry: 2fyu (more details), 2.26 Å

PDB Description: Crystal structure of bovine heart mitochondrial bc1 with jg144 inhibitor
PDB Compounds: (K:) Ubiquinol-cytochrome c reductase complex 6.4 kDa protein

SCOP Domain Sequences for d2fyuk1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fyuk1 f.23.15.1 (K:1-53) Subunit XI (6.4 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus) [TaxId: 9913]}
mltrflgpryrqlarnwvptaslwgavgavglvwatdwrlildwvpyingkfk

SCOP Domain Coordinates for d2fyuk1:

Click to download the PDB-style file with coordinates for d2fyuk1.
(The format of our PDB-style files is described here.)

Timeline for d2fyuk1: