![]() | Class f: Membrane and cell surface proteins and peptides [56835] (58 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (38 superfamilies) not a true fold |
![]() | Superfamily f.23.15: Subunit XI (6.4 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81518] (1 family) ![]() |
![]() | Family f.23.15.1: Subunit XI (6.4 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81517] (1 protein) |
![]() | Protein Subunit XI (6.4 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81516] (1 species) the smallest subunit of the complex, interacts with subunit 10 and ISP, peripherally located |
![]() | Species Cow (Bos taurus) [TaxId:9913] [81515] (15 PDB entries) Uniprot P07552 |
![]() | Domain d2fyuk1: 2fyu K:1-53 [145179] Other proteins in same PDB: d2fyua1, d2fyua2, d2fyub1, d2fyub2, d2fyuc1, d2fyuc2, d2fyud1, d2fyud2, d2fyuf1, d2fyug1, d2fyuh1, d2fyui1, d2fyuj1 automatically matched to 1SQQ K:1-54 complexed with fdn, fes, hem |
PDB Entry: 2fyu (more details), 2.26 Å
SCOP Domain Sequences for d2fyuk1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fyuk1 f.23.15.1 (K:1-53) Subunit XI (6.4 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus) [TaxId: 9913]} mltrflgpryrqlarnwvptaslwgavgavglvwatdwrlildwvpyingkfk
Timeline for d2fyuk1: