SCOPe 2.06: Domain d2fjub3: 2fju B:11-141

Lineage for d2fjub3 (2fju B:11-141)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins)
   Pfam PF00169

6. Protein Phospholipase C-beta-2 [159207] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [159208] (2 PDB entries)
   Uniprot Q00722 11-141

8. Domain d2fjub3: 2fju B:11-141 [145172]
   Other proteins in same PDB: d2fjua_, d2fjub1, d2fjub2, d2fjub4
   complexed with ca, gsp, mg

Details for d2fjub3

PDB Entry: 2fju, 2.2 Å

PDB Description: Activated Rac1 bound to its effector phospholipase C beta 2

PDB Compounds: (B:) 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta 2

SCOPe Domain Sequences for d2fjub3:

Sequence; same for both SEQRES and ATOM records:

>d2fjub3 b.55.1.1 (B:11-141) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]}
pkvkaylsqgerfikwddettvaspvilrvdpkgyylywtyqskemeflditsirdtrfg
kfakmpksqklrdvfnmdfpdnsfllktltvvsgpdmvdltfhnfvsykenvgkawaedv
lalvkhpltan

Timeline for d2fjub3:

• d2fjub3 first appeared in SCOP 1.75
  
• d2fjub3 appears in SCOPe 2.05
  
• d2fjub3 appears in SCOPe 2.07
  
• d2fjub3 appears in the current release, SCOPe 2.08