Lineage for d2fecb1 (2fec B:18-458)

  1. Root: SCOPe 2.03
  2. 1454900Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1456404Fold f.20: Clc chloride channel [81341] (1 superfamily)
    core: 18 transmembrane helices
  4. 1456405Superfamily f.20.1: Clc chloride channel [81340] (1 family) (S)
  5. 1456406Family f.20.1.1: Clc chloride channel [69912] (2 proteins)
    duplication: consist of two similar structural parts
  6. 1456407Protein Clc chloride channel [69913] (2 species)
  7. 1456408Species Escherichia coli [TaxId:562] [69914] (18 PDB entries)
  8. 1456438Domain d2fecb1: 2fec B:18-458 [145165]
    Other proteins in same PDB: d2fecl1, d2fecl2, d2feco1, d2feco2
    automatically matched to 2FEC A:17-460
    mutant

Details for d2fecb1

PDB Entry: 2fec (more details), 3.97 Å

PDB Description: Structure of the E203Q mutant of the Cl-/H+ exchanger CLC-ec1 from E.Coli
PDB Compounds: (B:) H(+)/Cl(-) exchange transporter clcA

SCOPe Domain Sequences for d2fecb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fecb1 f.20.1.1 (B:18-458) Clc chloride channel {Escherichia coli [TaxId: 562]}
rrqlirqllerdktplailfmaavvgtlvglaavafdkgvawlqnqrmgalvhtadnypl
lltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqrpvrwwrvlpvkffgglg
tlgggmvlgregptvqiggnigrmvldifrlkgdearhtllatgaaaglaaafnaplagi
lfiieqmrpqfrytlisikavfigvimstimyrifnhevalidvgklsdaplntlwlyli
lgiifgifgpifnkwvlgmqdllhrvhggnitkwvlmggaigglcgllgfvapatsgggf
nlipiatagnfsmgmlvfifvarvittllcfssgapggifapmlalgtvlgtafgmvave
lfpqyhleagtfaiagmgallaasirapltgiilvlemtdnyqlilpmiitglgatllaq
ftggkplysailartlakqea

SCOPe Domain Coordinates for d2fecb1:

Click to download the PDB-style file with coordinates for d2fecb1.
(The format of our PDB-style files is described here.)

Timeline for d2fecb1: